Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Hemoglobin subunit gamma-1/HBG1 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01435

Gamma chains make up the fetal hemoglobin F, in combination with alpha chains. Hemoglobin subunit gamma-1/HBG1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 23.0 kDa and the accession number is P69891.

Hemoglobin subunit gamma-1/HBG1 Protein, Human, Recombinant (His & Myc)

Hemoglobin subunit gamma-1/HBG1 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-01435
Gamma chains make up the fetal hemoglobin F, in combination with alpha chains. Hemoglobin subunit gamma-1/HBG1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 23.0 kDa and the accession number is P69891.
Pack SizePriceAvailabilityQuantity
20 μg$23720 days
100 μg$44620 days
1 mg$1,92020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Gamma chains make up the fetal hemoglobin F, in combination with alpha chains. Hemoglobin subunit gamma-1/HBG1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 23.0 kDa and the accession number is P69891.
Species
Human
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberP69891
Synonyms
Hemoglobin subunit gamma-1,Hemoglobin gamma-A chain,Hemoglobin gamma-1 chain,HBG1,Hb F Agamma,Gamma-1-globin
Amino Acid
GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH
Construction
2-147 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight23.0 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.