Component of the cytoskeleton-like structure which stabilizes the shape of the wall-less Mycoplasma. This cytoskeleton-like network of accessory proteins containing HMW proteins 1 to 5 allows the proper anchoring of cytadhesin proteins in the mycoplasmal membrane at the attachment organelle.

Mycoplasma pneumoniae

E. coli

Cytadherence accessory protein 1,Cytadherence high molecular weight protein 1,hmw1

MKKSKEAVFEDKDYTEENPEQIFGNLYDGKLTVQDGKVKIAYDGDGNGYYIAFNSETGVYYDPYGDTEYDISVLFDANGNSFVFADAPTVEVLAGEQEQTEAEPDYLQYVGNEAYGYYDEAGEWVWSGY

1-139 aa

> 90% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Component of the cytoskeleton-like structure which stabilizes the shape of the wall-less Mycoplasma. This cytoskeleton-like network of accessory proteins containing HMW proteins 1 to 5 allows the proper anchoring of cytadhesin proteins in the mycoplasmal membrane at the attachment organelle.