Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.

Human coronavirus 229E Membrane protein (His) is expressed in E. coli.

HCoV-229E

E. coli

Membrane protein,Membrane glycoprotein,Matrix glycoprotein,M,E1 glycoprotein

ANSFRLFRRARTFWAWNPEVNAITVTTVLGQTYYQPIQQAPTGITVTLLSGVLYVDGHRLASGVQVHNLPEYMTVAVPSTTIIYSRVGRSVNSQNSTGWVFYVRVKHGDFSAVSSPMSNMTENERLLHFF

96-225 aa

> 85% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Component of the viral envelope that plays a central role in virus morphogenesis and assembly via its interactions with other viral proteins.