Shopping Cart
- Remove All
- Your shopping cart is currently empty
Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His) is expressed in E. coli.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $360 | 20 days | |
100 μg | $678 | 20 days | |
1 mg | $2,300 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Human cytomegalovirus (HCMV) (strain AD169) Uncharacterized protein UL128 (His) is expressed in E. coli. |
Species | HHV-5 |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | P16837 |
Synonyms | Uncharacterized protein UL128,UL128 |
Amino Acid | MSPKDLTPFLTTLWLLLGHSRVPRVRAEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ |
Construction | 1-171 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 23.7 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Plays a role in viral entry into host cells. Forms a pentameric complex at the surface of the viral envelope together with gH, gL, UL130 and UL131. This complex is required for entry in epithelial, endothelial and myeloid host cells. Mechanistically, engages host receptor(s) including neurophilin 2/NRP2 to mediate infection. Additionally, monomeric UL128 may interfere with certain inflammatory cytokines to increase infection and dissemination by blocking monocytes migration. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.