Shopping Cart
- Remove All
- Your shopping cart is currently empty
IFN-omega Protein, Bovine, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 35.7 kDa and the accession number is P07352.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $360 | 20 days | |
100 μg | $745 | 20 days | |
1 mg | $2,530 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | IFN-omega Protein, Bovine, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 35.7 kDa and the accession number is P07352. |
Species | Bovine |
Expression System | E. coli |
Tag | N-6xHis-SUMO |
Accession Number | P07352 |
Synonyms | Interferon omega-1,Interferon alpha-II-1,IFNW1,IFNW,IFN-omega-c1 |
Amino Acid | CDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEVSQFQEAQAISVLHEMLQQSFNLFHKERSSAAWDTTLLEQLLTGLHQQLDDLDACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCAWEIVRLEIMRSLSSSTSLQERLRMMDGDLKSP |
Construction | 24-195 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 35.7 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.