Shopping Cart
- Remove All
- Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $284 | 20 days | |
100 μg | $536 | 20 days | |
500 μg | $1,480 | 20 days |
Biological Information | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Associates with IFNAR1 to form the plasma membrane receptor in the type I interferon signaling pathway. Directly involved in signal transduction through its association with the TYR kinase JAK1. Involved in interferon-mediated STAT1, STAT2 and STAT3 activation.; May be potent inhibitors of type I IFN receptor activity.; May be potent inhibitors of type I IFN receptor activity. IFNAR2 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 26.8 kDa and the accession number is O35664. |
Species | Mouse |
Expression System | P. pastoris (Yeast) |
Tag | N-6xHis |
Accession Number | O35664 |
Synonyms | Type I interferon receptor 2,Interferon alpha/beta receptor 2,Ifnar2 |
Amino Acid | SLETITPSAFDGYPDEPCTINITIRNSRLILSWELENKSGPPANYTLWYTVMSKDENLTKVKNCSDTTKSSCDVTDKWLEGMESYVVAIVIVHRGDLTVCRCSDYIVPANAPLEPPEFEIVGFTDHINVTMEFPPVTSKIIQEKMKTTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLRDLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSESA |
Construction | 22-242 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 26.8 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Associates with IFNAR1 to form the plasma membrane receptor in the type I interferon signaling pathway. Directly involved in signal transduction through its association with the TYR kinase JAK1. Involved in interferon-mediated STAT1, STAT2 and STAT3 activation.; May be potent inhibitors of type I IFN receptor activity.; May be potent inhibitors of type I IFN receptor activity. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.