Activity testing is in progress. It is theoretically active, but we cannot guarantee it.

IFNLR1 Protein, Human, Recombinant is expressed in E. coli with Tag Free. The accession number is Q8IU57.

Human

E. coli

Likely interleukin or cytokine receptor 2 (LICR2),LICR2,Interleukin-28 receptor subunit alpha (IL-28 receptor subunit alpha;IL-28R-alpha;IL-28RA),Interferon lambda receptor 1,IL28RA,IFNLR1,IFN-lambda-R1,IFN-lambda receptor 1,Cytokine receptor family 2 member 12 (CRF2-12),Cytokine receptor class-II member 12

RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA

21-228 aa

>85% as determined by SDS-PAGE.

Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.