Shopping Cart
- Remove All
Your shopping cart is currently empty
IGLC1 Protein, Human, Recombinant (His)
Catalog No. TMPH-03970
IGLC1 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P0CG04.
IGLC1 Protein, Human, Recombinant (His)
Catalog No. TMPH-03970
IGLC1 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P0CG04.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $465 | 20 days | |
| 100 μg | $1,300 | 20 days | |
| 1 mg | $5,480 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity testing is in progress. It is theoretically active, but we cannot guarantee it. |
| Description | IGLC1 Protein, Human, Recombinant (His) is expressed in HEK293 Cells with C-10xHis. The accession number is P0CG04. |
| Species | Human |
| Expression System | HEK293 Cells |
| Tag | C-10xHis |
| Accession Number | P0CG04 |
| Synonyms | Immunoglobulin lambda constant 1,IGLC1,Ig lambda-1 chain C region,Ig lambda chain C region MGC |
| Amino Acid | GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS |
| Construction | 1-106 aa |
| Protein Purity | >90% as determined by SDS-PAGE. |
| Molecular Weight | 14.1 kDa (Predicted) |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.