Shopping Cart
- Remove All
- Your shopping cart is currently empty
Insulin-1 Protein, Mouse, Recombinant (His & Myc) is expressed in Yeast.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $341 | 20 days | |
100 μg | $646 | 20 days | |
500 μg | $1,780 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Insulin-1 Protein, Mouse, Recombinant (His & Myc) is expressed in Yeast. |
Species | Mouse |
Expression System | P. pastoris (Yeast) |
Tag | N-6xHis, C-Myc |
Accession Number | P01325 |
Synonyms | Insulin-1,Ins1 |
Amino Acid | FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN |
Construction | 25-108 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 13.0 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.