Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

KIR2DS3 Protein, Human, Recombinant (His)

Catalog No. TMPH-01589

Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

KIR2DS3 Protein, Human, Recombinant (His)

KIR2DS3 Protein, Human, Recombinant (His)

Catalog No. TMPH-01589
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Pack SizePriceAvailabilityQuantity
20 μg$28420 days
100 μg$53620 days
500 μg$1,48020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.
Species
Human
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberQ14952
Synonyms
Natural killer-associated transcript 7,KIR2DS3,Killer cell immunoglobulin-like receptor 2DS3
Amino Acid
HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Construction
22-245 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight26.7 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.