Shopping Cart
- Remove All
![TargetMol](https://newstatic.targetmol.com/error/oops.webp)
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|
Biological Information | A Homogeneous Time-Resolved Fluorescence (HTRF) based system was established for the protein-protein interaction between KRAS-G12S and its interacting protein SOS1. The positive compound, SOS1 inhibitor BI3406, exhibited an inhibitory activity (IC50) of approximately 18 nM, consistent with reported activities in the literature. |
Description | KRAS Protein, Human, Recombinant (G12S, GST) is expressed in E. coli expression system with GST tag. The accession number is P01116. |
Species | Human |
Expression System | E. coli |
Tag | N-GST |
Accession Number | P01116 |
Synonyms | NS,C-K-RAS,K-RAS2A,KRAS1,K-RAS2B,KRAS2,K-RAS4A,CFC2,RALD,K-RAS,NS3,KI-RAS,Kirsten rat sarcoma viral oncogene homolog,RASK2,K-RAS4B |
Amino Acid | MTEYKLVVVGASGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK |
Construction | A DNA sequence encoding the Human KRAS-G12S (uniprot# P01116) (Met1-Lys169) was expressed with a GST tag at the N-terminus |
Protein Purity | >90% as determined by SDS-PAGE. |
Formulation | Supplied as a 0.2 μm filtered solution of 20 mM Hepes (PH=8.0), 150 mM NaCl, 1 mM DTT |
Stability & Storage | It is recommended to store the product under sterile conditions at -20°C to -80°C. Samples are stable for up to 12 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | K-Ras belongs to the small GTPase superfamily, Ras family. As other members of the Ras family, K-Ras is a GTPase and is an early player in many signal transduction pathways. It is usually tethered to cell membranes because of the presence of an isoprenyl group on its C-terminus. K-Ras functions as a molecular on/off switch. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation. Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner. Besides essential function in normal tissue signaling, the mutation of a K-Ras gene is an essential step in the development of many cancers. Several germline K-Ras mutations have been found to be associated with Noonan syndrome[4] and cardio-facio-cutaneous syndrome. Somatic K-Ras mutations are found at high rates in Leukemias, colon cancer, pancreatic cancer and lung cancer. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.