Shopping Cart
- Remove All
- Your shopping cart is currently empty
LASP1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 31.2 kDa; 43 kDa, reducing conditions and the accession number is Q14847.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $1,070 | In Stock |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | LASP1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 31.2 kDa; 43 kDa, reducing conditions and the accession number is Q14847. |
Species | Human |
Expression System | P. pastoris (Yeast) |
Tag | C-6xHis |
Accession Number | Q14847 |
Synonyms | Metastatic lymph node gene 50 protein,LIM and SH3 domain protein 1,LASP1 |
Amino Acid | MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI |
Construction | 1-261 aa |
Protein Purity | > 85% as determined by SDS-PAGE. ![]() |
Molecular Weight | 31.2 kDa (predicted); 43 kDa (reducing conditions) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0. |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.