LASP1 Protein, Human, Recombinant (His)

Catalog No. TMPH-00003

LASP1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 31.2 kDa; 43 kDa, reducing conditions and the accession number is Q14847.

LASP1 Protein, Human, Recombinant (His)

Catalog No. TMPH-00003

LASP1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 31.2 kDa; 43 kDa, reducing conditions and the accession number is Q14847.

Pack Size	Price	Availability	Quantity
20 μg	$1,070	In Stock

Bulk & Custom

Add to Cart

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	LASP1 Protein, Human, Recombinant (His) is expressed in yeast with C-6xHis tag. The predicted molecular weight is 31.2 kDa; 43 kDa, reducing conditions and the accession number is Q14847.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	C-6xHis
Accession Number	Q14847
Synonyms	Metastatic lymph node gene 50 protein,LIM and SH3 domain protein 1,LASP1
Amino Acid	MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNIKYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Construction	1-261 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	31.2 kDa (predicted); 43 kDa (reducing conditions)
Formulation	Lyophilized from 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.