Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

LY6E Protein, Mouse, Recombinant (B2M & His)

Catalog No. TMPH-02766

LY6E Protein, Mouse, Recombinant (B2M & His) is expressed in E. coli.

LY6E Protein, Mouse, Recombinant (B2M & His)

LY6E Protein, Mouse, Recombinant (B2M & His)

Catalog No. TMPH-02766
LY6E Protein, Mouse, Recombinant (B2M & His) is expressed in E. coli.
Pack SizePriceAvailabilityQuantity
20 μg$28420 days
100 μg$53720 days
1 mg$2,30020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
LY6E Protein, Mouse, Recombinant (B2M & His) is expressed in E. coli.
Species
Mouse
Expression System
E. coli
TagN-6xHis-B2M
Accession NumberQ64253
Synonyms
Thymic shared antigen 1,Stem cell antigen 2,Lymphocyte antigen 6E,Ly6e
Amino Acid
LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Construction
27-108 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight22.8 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
GPI-anchored cell surface protein that regulates T-lymphocytes proliferation, differentiation, and activation. Regulates the T-cell receptor (TCR) signaling by interacting with component CD3Z/CD247 at the plasma membrane, leading to CD3Z/CD247 phosphorylation modulation. Restricts the entry of murine coronavirus, mouse hepatitis virus, by interfering with spike protein-mediated membrane fusion. Plays also an essential role in placenta formation by acting as the main receptor for syncytin-A (SynA). Therefore, participates in the normal fusion of syncytiotrophoblast layer I (SynT-I) and in the proper morphogenesis of both fetal and maternal vasculatures within the placenta. May also act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.