Shopping Cart
- Remove All
Your shopping cart is currently empty
Lysozyme C Protein, Chicken, Recombinant(E53A)
Catalog No. TMPH-00377
Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has bacteriolytic activity against M.luteus. Lysozyme C Protein, Chicken, Recombinant(E53A) is expressed in E. coli expression system. The predicted molecular weight is 14.4 kDa and the accession number is P00698.
Lysozyme C Protein, Chicken, Recombinant(E53A)
Catalog No. TMPH-00377
Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has bacteriolytic activity against M.luteus. Lysozyme C Protein, Chicken, Recombinant(E53A) is expressed in E. coli expression system. The predicted molecular weight is 14.4 kDa and the accession number is P00698.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | 489 € | 20 days | |
| 100 μg | 791 € | 20 days | |
| 1 mg | 2.327 € | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has bacteriolytic activity against M.luteus. Lysozyme C Protein, Chicken, Recombinant(E53A) is expressed in E. coli expression system. The predicted molecular weight is 14.4 kDa and the accession number is P00698. |
| Species | Chicken |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P00698 |
| Synonyms | LYZ,Lysozyme C,Allergen Gal d IV,1,4-beta-N-acetylmuramidase C |
| Amino Acid | KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFASNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL |
| Construction | 19-147 aa (E53A) |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 14.4 kDa (predicted) |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents. Has bacteriolytic activity against M.luteus. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.