Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.

Muellerian-inhibiting factor/AMH Protein, Mouse, Recombinant (His) is expressed in Yeast.

Mouse

P. pastoris (Yeast)

Muellerian-inhibiting substance,Muellerian-inhibiting factor,Anti-Muellerian hormone,Amh

DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC

450-552 aa

> 90% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.