Shopping Cart
- Remove All
- Your shopping cart is currently empty
MYL9 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-10xHis. The accession number is P24844.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $397 | 20 days | |
100 μg | $769 | 20 days | |
1 mg | $2,760 | 20 days |
Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2 μg/mL can bind Anti-MYL9 recombinant antibody (CSB-RA015318MA1HU), the EC50 is 4.628-6.430 ng/mL. |
Description | MYL9 Protein, Human, Recombinant (His) is expressed in P. pastoris (Yeast) with C-10xHis. The accession number is P24844. |
Species | Human |
Expression System | P. pastoris (Yeast) |
Tag | C-10xHis |
Accession Number | P24844 |
Synonyms | MYRL2,Myosin RLC,Myosin regulatory light polypeptide 9,Myosin regulatory light chain MRLC1,Myosin regulatory light chain 9,Myosin regulatory light chain 2, smooth muscle isoform,MYL9,MRLC1,MLC-2C,MLC2,20 kDa myosin light chain (LC20) |
Amino Acid | SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD |
Construction | 2-172 aa |
Protein Purity | >95% as determined by SDS-PAGE. |
Molecular Weight | 21.7 kDa (Predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.