Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Napsin-A/NAPSA Protein, Human, Recombinant (His)

Catalog No. TMPH-01750

May be involved in processing of pneumocyte surfactant precursors. Napsin-A/NAPSA Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 42.5 kDa and the accession number is O96009.

Napsin-A/NAPSA Protein, Human, Recombinant (His)

Napsin-A/NAPSA Protein, Human, Recombinant (His)

Catalog No. TMPH-01750
May be involved in processing of pneumocyte surfactant precursors. Napsin-A/NAPSA Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 42.5 kDa and the accession number is O96009.
Pack SizePriceAvailabilityQuantity
20 μg $19820 days
100 μg $42720 days
1 mg $1,83020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
May be involved in processing of pneumocyte surfactant precursors. Napsin-A/NAPSA Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 42.5 kDa and the accession number is O96009.
Species
Human
Expression System
E. coli
TagN-6xHis
Accession NumberO96009
Synonyms
TA01/TA02,Napsin-A,Napsin-1,NAPSA,Aspartyl protease 4
Amino Acid
KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
Construction
64-420 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight42.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
May be involved in processing of pneumocyte surfactant precursors.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.