Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.

Nkx-3.2 Protein, Mouse, Recombinant (His & Myc) is expressed in E. coli.

Mouse

E. coli

Nkx3-2,Homeobox protein Nkx-3.2,Homeobox protein NK-3 homolog B,Bagpipe homeobox protein homolog 1

MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ

1-333 aa

> 90% as determined by SDS-PAGE.

A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.

Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.

Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.