Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

NT-4 Protein, Human, Recombinant (Active)

Catalog No. TMPH-04034

NT-4 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P34130.

NT-4 Protein, Human, Recombinant (Active)

NT-4 Protein, Human, Recombinant (Active)

Catalog No. TMPH-04034
NT-4 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P34130.
Pack SizePriceAvailabilityQuantity
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent induction of choline acetyl transferase activity in rat basal forebrain primary septal cell cultures is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg
Description
NT-4 Protein, Human, Recombinant (Active) is expressed in E. coli with Tag Free. The accession number is P34130.
Species
Human
Expression System
E. coli
TagTag Free
Accession NumberP34130
Amino Acid
M+GVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Construction
81-210 aa
Protein Purity
>97% as determined by SDS-PAGE.
Molecular Weight14.1 kDa (Predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from a 0.2 µm filtered PBS, pH 5.5
Reconstitution
Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.