NUP210 Protein, Human, Recombinant (His)

Catalog No. TMPH-01790

Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity. NUP210 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.5 kDa and the accession number is Q8TEM1.

NUP210 Protein, Human, Recombinant (His)

Catalog No. TMPH-01790

Pack Size	Price	Availability
20 μg	$198	20 days
100 μg	$389	20 days
1 mg	$1,680	20 days

Bulk & Custom

Add to Cart

Questions

Resource Download

User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity. NUP210 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 34.5 kDa and the accession number is Q8TEM1.
Species	Human
Expression System	E. coli
Tag	N-6xHis
Accession Number	Q8TEM1
Synonyms	Pore membrane protein of 210 kDa,NUP210,Nucleoporin Nup210,Nuclear pore membrane glycoprotein 210,Nuclear envelope pore membrane protein POM 210
Amino Acid	AVGSVTVYYEVAGHLRTYKEVVVSVPQRIMARHLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVFDFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQVGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLFQHFLDSYQ
Construction	1529-1808 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	34.5 kDa (predicted)
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.