OBP2A Protein, Human, Recombinant (C114S & K127N, His & SUMO)

Catalog No. TMPH-01806

Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids. OBP2A Protein, Human, Recombinant (C114S & K127N, His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.8 kDa and the accession number is Q9NY56.

OBP2A Protein, Human, Recombinant (C114S & K127N, His & SUMO)

Catalog No. TMPH-01806

Pack Size	Price	Availability
20 μg	$198	20 days
100 μg	$389	20 days
1 mg	$1,680	20 days

Bulk & Custom

Add to Cart

Questions

Resource Download

User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids. OBP2A Protein, Human, Recombinant (C114S & K127N, His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 30.8 kDa and the accession number is Q9NY56.
Species	Human
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	Q9NY56
Synonyms	Odorant-binding protein IIa,Odorant-binding protein 2a,OBP2A
Amino Acid	LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYSKDQRRGGLRYMGNLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH
Construction	16-170 aa (C114S,K127N)
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	30.8 kDa (predicted)
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.