Shopping Cart
- Remove All
Your shopping cart is currently empty
OX1R Protein, Human, Recombinant (His & SUMOstar)
Catalog No. TMPH-01816
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. OX1R Protein, Human, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 21.4 kDa and the accession number is O43613.
OX1R Protein, Human, Recombinant (His & SUMOstar)
Catalog No. TMPH-01816
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. OX1R Protein, Human, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 21.4 kDa and the accession number is O43613.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $341 | 20 days | |
| 100 μg | $646 | 20 days | |
| 500 μg | $1,780 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. OX1R Protein, Human, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-sumostar tag. The predicted molecular weight is 21.4 kDa and the accession number is O43613. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis-SUMOstar |
| Accession Number | O43613 |
| Synonyms | Orexin/Hypocretin receptor type 1,Orexin receptor type 1,Hypocretin receptor type 1,HCRTR1 |
| Amino Acid | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE |
| Construction | 1-46 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 21.4 kDa (predicted) |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.