OXT Protein, Human, Recombinant (His)

Catalog No. TMPH-01820

Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.6 kDa and the accession number is P01178.

OXT Protein, Human, Recombinant (His)

Catalog No. TMPH-01820

Pack Size	Price	Availability
20 μg	$341	In Stock
100 μg	$646	20 days
500 μg	$1,780	20 days

Bulk & Custom

Add to Cart

Questions

Select Batch

Resource Download

COA User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR). OXT Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 11.6 kDa and the accession number is P01178.
Species	Human
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	P01178
Synonyms	Oxytocin-neurophysin 1,OXT
Amino Acid	AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Construction	32-125 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	11.6 kDa (predicted)
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Neurophysin 1 specifically binds oxytocin.; Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Acts by binding to oxytocin receptor (OXTR).

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.