Shopping Cart
- Remove All
- Your shopping cart is currently empty
PARP14 Protein, Human, Recombinant (His & Myc) is expressed in HEK293.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $127 | 20 days | |
100 μg | $350 | 20 days | |
1 mg | $2,550 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | PARP14 Protein, Human, Recombinant (His & Myc) is expressed in HEK293. |
Species | Human |
Expression System | HEK293 Cells |
Tag | N-10xHis, C-Myc |
Accession Number | Q460N5 |
Synonyms | Protein mono-ADP-ribosyltransferase PARP14,Poly [ADP-ribose] polymerase 14,PARP14,B aggressive lymphoma protein 2,ADP-ribosyltransferase diphtheria toxin-like 8 |
Amino Acid | IPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQLFHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTHGNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK |
Construction | 1605-1801 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 27.6 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | ADP-ribosyltransferase that mediates mono-ADP-ribosylation of glutamate residues on target proteins. In contrast to PARP1 and PARP2, it is not able to mediate poly-ADP-ribosylation. Has been shown to catalyze the mono-ADP-ribosylation of STAT1 at 'Glu-657' and 'Glu-705', thus decreasing STAT1 phosphorylation which negatively regulates pro-inflammatory cytokine production in macrophages in response to IFNG stimulation. However, the role of ADP-ribosylation in the prevention of STAT1 phosphorylation has been called into question and it has been suggested that the inhibition of phosphorylation may be the result of sumoylation of STAT1 'Lys-703'. Mono-ADP-ribosylates STAT6; enhancing STAT6-dependent transcription. In macrophages, positively regulates MRC1 expression in response to IL4 stimulation by promoting STAT6 phosphorylation. Mono-ADP-ribosylates PARP9. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.