Shopping Cart
- Remove All
- Your shopping cart is currently empty
Penicillin-binding proteins (PBPs) function in the late steps of murein biosynthesis. Probably required for both cortical and vegetative peptidoglycan synthesis. Although not usually required for cell division, in the absence of PBP 2B (pbpB) it becomes essential. Confers resistance to oxacillin and cephalexin. PBP 3 Protein, Bacillus subtilis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 29.2 kDa and the accession number is P42971.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $360 | 20 days | |
100 μg | $745 | 20 days | |
1 mg | $2,530 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | Penicillin-binding proteins (PBPs) function in the late steps of murein biosynthesis. Probably required for both cortical and vegetative peptidoglycan synthesis. Although not usually required for cell division, in the absence of PBP 2B (pbpB) it becomes essential. Confers resistance to oxacillin and cephalexin. PBP 3 Protein, Bacillus subtilis, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 29.2 kDa and the accession number is P42971. |
Species | Bacillus subtilis |
Expression System | E. coli |
Tag | N-6xHis |
Accession Number | P42971 |
Synonyms | PSPB20,Penicillin-binding protein C,Penicillin-binding protein 3,pbpC |
Amino Acid | CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT |
Construction | 21-240 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 29.2 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Penicillin-binding proteins (PBPs) function in the late steps of murein biosynthesis. Probably required for both cortical and vegetative peptidoglycan synthesis. Although not usually required for cell division, in the absence of PBP 2B (pbpB) it becomes essential. Confers resistance to oxacillin and cephalexin. |
Copyright © 2015-2025 TargetMol Chemicals Inc. All Rights Reserved.