Shopping Cart

Remove All

Your shopping cart is currently empty

Plastocyanin Protein, Spinacia oleracea, Recombinant (His & SUMO)

Resource Download

Plastocyanin Protein, Spinacia oleracea, Recombinant (His & SUMO)

Catalog No. TMPH-03513

Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I. Plastocyanin Protein, Spinacia oleracea, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 26.4 kDa and the accession number is P00289.

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Pack Size	Price	Availability
20 μg	$360	20 days
100 μg	$678	20 days
1 mg	$2,300	20 days

Bulk & Custom

Add to Cart

Questions

Biological Description

Description	Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I. Plastocyanin Protein, Spinacia oleracea, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 26.4 kDa and the accession number is P00289.
Species	Spinacia oleracea
Expression System	E. coli
Tag	N-6xHis-SUMO
Accession Number	P00289
Synonyms	Plastocyanin, chloroplastic,PETE
Amino Acid	VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Construction	70-168 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	26.4 kDa (predicted)
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.