Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Porin MspA Protein, Mycobacterium smegmatis, Recombinant (His)

Catalog No. TMPH-02998

Porin MspA Protein, Mycobacterium smegmatis, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 25.4 kDa and the accession number is A0QR29.

Porin MspA Protein, Mycobacterium smegmatis, Recombinant (His)

Porin MspA Protein, Mycobacterium smegmatis, Recombinant (His)

Catalog No. TMPH-02998
Porin MspA Protein, Mycobacterium smegmatis, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 25.4 kDa and the accession number is A0QR29.
Pack SizePriceAvailabilityQuantity
20 μg $36020 days
100 μg $74520 days
1 mg $2,53020 days
Bulk & Custom
Add to Cart
Questions
View More
Select Batch
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Porin MspA Protein, Mycobacterium smegmatis, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 25.4 kDa and the accession number is A0QR29.
Species
Mycobacterium smegmatis
Expression System
E. coli
TagN-10xHis
Accession NumberA0QR29
Synonyms
Porin MspA,mspA
Amino Acid
GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGFPWSLGVGINFSYTTPNILIDDGDITAPPFGLNSVITPNLFPGVSISADLGNGPGIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN
Construction
28-211 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight25.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
Formulation0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
The major porin in this organism, forms a water-filled channel which favors the permeation of cations, amino acids, iron Fe(3+) and less efficiently phosphate. Does not transport Fe-ExoMS, the predominant siderophore. Plays a role in transport of beta-lactamase and hydrophilic fluoroquinolone antibiotics such as norfloxacin as well as chloramphenicol. There are about 2400 porins in wild-type, 800 in an mspA deletion and 150 in a double mspA-mspC deletion. Different conductance values with maxima at 2.3 and 4.6 nanosiemens might be caused by a simultaneous reconstitution of MspA channels into the membrane or by the existence of different MspA conformations.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.