PrgJ Protein, Salmonella typhimurium, Recombinant (Yeast, His & Myc)

Catalog No. TMPH-03480

Required for invasion of epithelial cells. PrgJ Protein, Salmonella typhimurium, Recombinant (Yeast, His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 14.4 kDa and the accession number is P41785.

PrgJ Protein, Salmonella typhimurium, Recombinant (Yeast, His & Myc)

Catalog No. TMPH-03480

Pack Size	Price	Availability
20 μg	$397	20 days
100 μg	$769	20 days
500 μg	$1,780	20 days

Bulk & Custom

Add to Cart

Questions

Resource Download

User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Required for invasion of epithelial cells. PrgJ Protein, Salmonella typhimurium, Recombinant (Yeast, His & Myc) is expressed in yeast with N-6xHis and C-Myc tag. The predicted molecular weight is 14.4 kDa and the accession number is P41785.
Species	Salmonella typhimurium
Expression System	P. pastoris (Yeast)
Tag	N-6xHis, C-Myc
Accession Number	P41785
Synonyms	Protein PrgJ,prgJ
Amino Acid	MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS
Construction	1-101 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	14.4 kDa (predicted)
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Required for invasion of epithelial cells.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.