Shopping Cart
- Remove All
Your shopping cart is currently empty
S100A7A Protein, Human, Recombinant (His)
Catalog No. TMPH-01951
May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. S100A7A Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.2 kDa and the accession number is Q86SG5.
S100A7A Protein, Human, Recombinant (His)
Catalog No. TMPH-01951
May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. S100A7A Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.2 kDa and the accession number is Q86SG5.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $231 | 20 days | |
| 100 μg | $437 | 20 days | |
| 1 mg | $1,870 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. S100A7A Protein, Human, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 13.2 kDa and the accession number is Q86SG5. |
| Species | Human |
| Expression System | P. pastoris (Yeast) |
| Tag | N-6xHis |
| Accession Number | Q86SG5 |
| Synonyms | S100A7A,S100 calcium-binding protein A7-like 1,S100 calcium-binding protein A7A,S100 calcium-binding protein A15,Protein S100-A7A |
| Amino Acid | SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ |
| Construction | 2-101 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 13.2 kDa (predicted) |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.