Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SAM22 Protein, Glycine max, Recombinant (His)

Catalog No. TMPH-00774

Involved in disease resistance. SAM22 Protein, Glycine max, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.8 kDa and the accession number is P26987.

SAM22 Protein, Glycine max, Recombinant (His)

SAM22 Protein, Glycine max, Recombinant (His)

Catalog No. TMPH-00774
Involved in disease resistance. SAM22 Protein, Glycine max, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.8 kDa and the accession number is P26987.
Pack SizePriceAvailabilityQuantity
20 μg$39720 days
100 μg$76920 days
500 μg$1,78020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Involved in disease resistance. SAM22 Protein, Glycine max, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.8 kDa and the accession number is P26987.
Species
Glycine max
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberP26987
Synonyms
Stress-induced protein SAM22,Starvation-associated message 22,PR-10,Pathogenesis-related protein 10
Amino Acid
MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN
Construction
1-158 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight18.8 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Involved in disease resistance.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.