Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SFTPA1 Protein, Human, Recombinant (B2M & His & Myc)

Catalog No. TMPH-01978

In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.; (Microbial infection) Recognition of M.tuberculosis by dendritic cells may occur partially via this molecule. Can recognize, bind, and opsonize pathogens to enhance their elimination by alveolar macrophages. SFTPA1 Protein, Human, Recombinant (B2M & His & Myc) is expressed in E. coli expression system with N-10xHis-B2M and C-Myc tag. The predicted molecular weight is 41.2 kDa and the accession number is Q8IWL2.

SFTPA1 Protein, Human, Recombinant (B2M & His & Myc)

SFTPA1 Protein, Human, Recombinant (B2M & His & Myc)

Catalog No. TMPH-01978
In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.; (Microbial infection) Recognition of M.tuberculosis by dendritic cells may occur partially via this molecule. Can recognize, bind, and opsonize pathogens to enhance their elimination by alveolar macrophages. SFTPA1 Protein, Human, Recombinant (B2M & His & Myc) is expressed in E. coli expression system with N-10xHis-B2M and C-Myc tag. The predicted molecular weight is 41.2 kDa and the accession number is Q8IWL2.
Pack SizePriceAvailabilityQuantity
20 μg $78020 days
100 μg $1,26020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.; (Microbial infection) Recognition of M.tuberculosis by dendritic cells may occur partially via this molecule. Can recognize, bind, and opsonize pathogens to enhance their elimination by alveolar macrophages. SFTPA1 Protein, Human, Recombinant (B2M & His & Myc) is expressed in E. coli expression system with N-10xHis-B2M and C-Myc tag. The predicted molecular weight is 41.2 kDa and the accession number is Q8IWL2.
Species
Human
Expression System
E. coli
TagN-10xHis-B2M, C-Myc
Accession NumberQ8IWL2
Synonyms
SFTPA1,Pulmonary surfactant-associated protein A1,Collectin-4,Alveolar proteinosis protein,35 kDa pulmonary surfactant-associated protein
Amino Acid
EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Construction
21-248 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight41.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationLyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of MYO18A/SP-R210 on alveolar macrophages.; (Microbial infection) Recognition of M.tuberculosis by dendritic cells may occur partially via this molecule. Can recognize, bind, and opsonize pathogens to enhance their elimination by alveolar macrophages.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.