Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SFTPC Protein, Human, Recombinant (GST)

Catalog No. TMPH-01980

SFTPC Protein, Human, Recombinant (GST) is expressed in E. coli.

SFTPC Protein, Human, Recombinant (GST)

SFTPC Protein, Human, Recombinant (GST)

Catalog No. TMPH-01980
SFTPC Protein, Human, Recombinant (GST) is expressed in E. coli.
Pack SizePriceAvailabilityQuantity
20 μg$19820 days
100 μg$38920 days
1 mg$1,68020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
SFTPC Protein, Human, Recombinant (GST) is expressed in E. coli.
Species
Human
Expression System
E. coli
TagN-GST
Accession NumberP11686
Synonyms
SP5,SFTPC,Pulmonary surfactant-associated proteolipid SPL(Val),Pulmonary surfactant-associated protein C
Amino Acid
FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL
Construction
24-58 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight30.7 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Pulmonary surfactant associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.