Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SLC5A2 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-02119

Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.; Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.

SLC5A2 Protein, Human, Recombinant (His & Myc)

SLC5A2 Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-02119
Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.; Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
Pack SizePriceAvailabilityQuantity
20 μg$23720 days
100 μg$44620 days
1 mg$1,92020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.; Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
Species
Human
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberP31639
Synonyms
Solute carrier family 5 member 2,Sodium/glucose cotransporter 2,SLC5A2,Low affinity sodium-glucose cotransporter
Amino Acid
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA
Construction
1-102 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight15.5 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1.; Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.