Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SMT3 Protein, S. cerevisiae, Recombinant (His & SUMO)

Catalog No. TMPH-03463

Not known; suppressor of MIF2 mutations.

SMT3 Protein, S. cerevisiae, Recombinant (His & SUMO)

SMT3 Protein, S. cerevisiae, Recombinant (His & SUMO)

Catalog No. TMPH-03463
Not known; suppressor of MIF2 mutations.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$67820 days
1 mg$2,30020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Not known; suppressor of MIF2 mutations.
Species
Saccharomyces cerevisiae
Expression System
E. coli
TagN-6xHis-SUMO
Accession NumberQ12306
Synonyms
Ubiquitin-like protein SMT3,SMT3
Amino Acid
SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG
Construction
2-98 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight27.1 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Not known; suppressor of MIF2 mutations.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.