Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Snaclec rhodocytin subunit beta Protein, Calloselasma rhodostoma, Recombinant (His)

Catalog No. TMPH-00322

Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial. Snaclec rhodocytin subunit beta Protein, Calloselasma rhodostoma, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.4 kDa and the accession number is Q9I840.

Snaclec rhodocytin subunit beta Protein, Calloselasma rhodostoma, Recombinant (His)

Snaclec rhodocytin subunit beta Protein, Calloselasma rhodostoma, Recombinant (His)

Catalog No. TMPH-00322
Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial. Snaclec rhodocytin subunit beta Protein, Calloselasma rhodostoma, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.4 kDa and the accession number is Q9I840.
Pack SizePriceAvailabilityQuantity
20 μg$39720 days
100 μg$76920 days
500 μg$1,78020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial. Snaclec rhodocytin subunit beta Protein, Calloselasma rhodostoma, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.4 kDa and the accession number is Q9I840.
Species
Calloselasma rhodostoma
Expression System
P. pastoris (Yeast)
TagN-6xHis
Accession NumberQ9I840
Synonyms
Snaclec rhodocytin subunit beta,Rhodoaggretin subunit beta,Aggretin beta chain
Amino Acid
DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA
Construction
24-146 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight16.4 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B/CLEC2). Binding leads to tyrosine phosphorylation in the cytoplasmic tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2/beta-1 (ITGA2/ITGB1) may also induce aggregation, but this is controversial.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.