Shopping Cart
- Remove All
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $284 | 20 days | |
100 μg | $536 | 20 days | |
500 μg | $1,480 | 20 days |
Description | Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. SPINK1 Protein, Mouse, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 8.1 kDa and the accession number is P09036. |
Species | Mouse |
Expression System | P. pastoris (Yeast) |
Tag | N-6xHis |
Accession Number | P09036 |
Synonyms | Serine protease inhibitor Kazal-type 3,Serine protease inhibitor Kazal-type 1,P12,Prostatic secretory glycoprotein,Spink1 |
Amino Acid | AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC |
Construction | 24-80 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 8.1 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.