SPINK9 Protein, Human, Recombinant (His)

Catalog No. TMPZ-00006

SPINK9 specifically inhibits KLK5, which may contribute to the regulation of the desquamation process in skin by inhibiting KLK5.
SPINK9 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 7.37 kDa and the accession number is Q5DT21.

SPINK9 Protein, Human, Recombinant (His)

Catalog No. TMPZ-00006

SPINK9 specifically inhibits KLK5, which may contribute to the regulation of the desquamation process in skin by inhibiting KLK5. SPINK9 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 7.37 kDa and the accession number is Q5DT21.

Pack Size	Price	Availability	Quantity

Bulk & Custom

Add to Cart

Questions

Resource Download

User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	SPINK9 specifically inhibits KLK5, which may contribute to the regulation of the desquamation process in skin by inhibiting KLK5._x000D_ SPINK9 Protein, Human, Recombinant (His) is expressed in HEK293 mammalian cells with His tag. The predicted molecular weight is 7.37 kDa and the accession number is Q5DT21.
Species	Human
Expression System	HEK298 Cells
Tag	N-His
Accession Number	Q5DT21
Synonyms	LEKTI2
Amino Acid	IECAKQTKQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVHFGKC
Construction	A DNA sequence encoding the human SPINK9 (20Ile - 86Cys) was expressed with a polyhistidine tag at the N-terminus.
Protein Purity	> 90 % as determined by SDS-PAGE.
Molecular Weight	7.37 kDa (Predicted)
Endotoxin	< 1.0 EU per μg protein as determined by the LAL method.
Formulation	Supplied as sterile solution in PBS, pH 7.4.
Stability & Storage	Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Shipping	Shipping with dry-ice
Research Background	SPINK9 specifically inhibits KLK5, which may contribute to the regulation of the desquamation process in skin by inhibiting KLK5.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.

Keywords

SPINK9Protein,Human,Recombinant(His)