Shopping Cart
- Remove All
- Your shopping cart is currently empty
STRA6 Protein, Human, Recombinant (hFc) is expressed in HEK293.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $614 | In Stock | |
100 μg | $1,720 | 20 days | |
1 mg | $7,240 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | STRA6 Protein, Human, Recombinant (hFc) is expressed in HEK293. |
Species | Human |
Expression System | HEK293 Cells |
Tag | C-hFc |
Accession Number | Q9BX79 |
Synonyms | STRA6,Stimulated by retinoic acid gene 6 protein homolog,Retinol-binding protein receptor STRA6,Receptor for retinol uptake STRA6 |
Amino Acid | MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG |
Construction | 1-50 aa |
Protein Purity | > 85% as determined by SDS-PAGE. |
Molecular Weight | 34.2 kDa (predicted) |
Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Functions as retinol transporter. Accepts all-trans retinol from the extracellular retinol-binding protein RBP4, facilitates retinol transport across the cell membrane, and then transfers retinol to the cytoplasmic retinol-binding protein RBP1. Retinol uptake is enhanced by LRAT, an enzyme that converts retinol to all-trans retinyl esters, the storage forms of vitamin A. Contributes to the activation of a signaling cascade that depends on retinol transport and LRAT-dependent generation of retinol metabolites that then trigger activation of JAK2 and its target STAT5, and ultimately increase the expression of SOCS3 and inhibit cellular responses to insulin. Important for the homeostasis of vitamin A and its derivatives, such as retinoic acid. STRA6-mediated transport is particularly important in the eye, and under conditions of dietary vitamin A deficiency. Does not transport retinoic acid. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.