Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

SULT1A1 Protein, Rat, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-03376

SULT1A1 Protein, Rat, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10XHis-SUMO and C-Myc tag. The predicted molecular weight is 53.9 kDa and the accession number is P17988.

SULT1A1 Protein, Rat, Recombinant (His & Myc & SUMO)

SULT1A1 Protein, Rat, Recombinant (His & Myc & SUMO)

Catalog No. TMPH-03376
SULT1A1 Protein, Rat, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10XHis-SUMO and C-Myc tag. The predicted molecular weight is 53.9 kDa and the accession number is P17988.
Pack SizePriceAvailabilityQuantity
20 μg$28420 days
100 μg$53720 days
1 mg$2,30020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
SULT1A1 Protein, Rat, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-10XHis-SUMO and C-Myc tag. The predicted molecular weight is 53.9 kDa and the accession number is P17988.
Species
Rat
Expression System
E. coli
TagN-10XHis-SUMO, C-Myc
Accession NumberP17988
Synonyms
Tyrosine-ester sulfotransferase,Sult1a1,Sulfotransferase 1A1,Sulfokinase,PST-1,Phenol sulfotransferase,Minoxidil sulfotransferase,Aryl sulfotransferase IV,Aryl sulfotransferase
Amino Acid
MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL
Construction
1-291 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight53.9 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of a wide variety of acceptor molecules bearing a hydroxyl or an amine groupe. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Displays broad substrate specificity for small phenolic compounds. Plays an important roles in the sulfonation of endogenous molecules such as steroid hormones and 3,3'-diiodothyronin. Mediates the sulfate conjugation of a variety of xenobiotics, including the drugs acetaminophen and minoxidil. Mediates also the metabolic activation of carcinogenic N-hydroxyarylamines leading to highly reactive intermediates capable of forming DNA adducts, potentially resulting in mutagenesis.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.