Shopping Cart
- Remove All
Your shopping cart is currently empty
Transthyretin Protein, Mouse, Recombinant
Catalog No. TMPH-02947
Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. Transthyretin Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 13.5 kDa and the accession number is P07309.
Transthyretin Protein, Mouse, Recombinant
Catalog No. TMPH-02947
Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. Transthyretin Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 13.5 kDa and the accession number is P07309.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $439 | 20 days | |
| 100 μg | $692 | 20 days | |
| 1 mg | $2,450 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. Transthyretin Protein, Mouse, Recombinant is expressed in E. coli expression system. The predicted molecular weight is 13.5 kDa and the accession number is P07309. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | Tag Free |
| Accession Number | P07309 |
| Synonyms | Ttr,Transthyretin,Prealbumin |
| Amino Acid | AGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN |
| Construction | 23-147 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 13.5 kDa (predicted) |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.