Shopping Cart
- Remove All
Your shopping cart is currently empty
YopE Protein, Yersinia enterocolitica, Recombinant (His)
Catalog No. TMPH-03717
Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.
YopE Protein, Yersinia enterocolitica, Recombinant (His)
Catalog No. TMPH-03717
Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | 741 € | 20 days | |
| 100 μg | 1.092 € | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis. |
| Species | Yersinia enterocolitica |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P31492 |
| Synonyms | yopE,Outer membrane virulence protein YopE |
| Amino Acid | MKISSFISTSLPLPASVSGSSSVGEMSGRSVSQQKSDQYANNLAGRTESPQGSSLASRIIERLSSMAHSVIGFIQRMFSEGSHKPVVTPALTPAQMPSPTSFSDSIKQLAAETLPKYMQQLSSLDAETLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTVGGAASAYVASGVDLTQAANEIKGLGQQMQQLLSLM |
| Construction | 1-219 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 26.9 kDa (predicted) |
| Formulation | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Essential virulence determinant; cytotoxic effector, involved in resistance to phagocytosis. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.