Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

ADTRP Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-00933

ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system.

ADTRP Protein, Human, Recombinant (His & Myc)

ADTRP Protein, Human, Recombinant (His & Myc)

Catalog No. TMPH-00933
ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system.
Pack SizePriceAvailabilityQuantity
20 μg$1,50020 days
100 μg$2,50020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system.
Species
Human
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberQ96IZ2
Synonyms
Fatty acid esters of hydroxy fatty acids hydrolase ADTRP,FAHFA hydrolase ADTRP,C6orf105,Androgen-dependent TFPI-regulating protein
Amino Acid
MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
Construction
1-230 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight31.8 kDa (predicted)
FormulationLyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids. Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids. Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.