Shopping Cart
- Remove All
- Your shopping cart is currently empty
ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $1,500 | 20 days | |
100 μg | $2,500 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | ADTRP Protein, Human, Recombinant (His & Myc) is expressed in in vitro E. coli expression system. |
Species | Human |
Expression System | E. coli |
Tag | N-10xHis, C-Myc |
Accession Number | Q96IZ2 |
Synonyms | Fatty acid esters of hydroxy fatty acids hydrolase ADTRP,FAHFA hydrolase ADTRP,C6orf105,Androgen-dependent TFPI-regulating protein |
Amino Acid | MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK |
Construction | 1-230 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 31.8 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids. Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids. Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro). |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.