Shopping Cart
- Remove All
Your shopping cart is currently empty
Carboxypeptidase A1 Protein, Rat, Recombinant (His & Myc)
Catalog No. TMPH-03260
Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro. Catalyzes the conversion of leukotriene C4 to leukotriene F4 via the hydrolysis of an amide bond. Carboxypeptidase A1 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 39.6 kDa and the accession number is P00731.
Carboxypeptidase A1 Protein, Rat, Recombinant (His & Myc)
Catalog No. TMPH-03260
Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro. Catalyzes the conversion of leukotriene C4 to leukotriene F4 via the hydrolysis of an amide bond. Carboxypeptidase A1 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 39.6 kDa and the accession number is P00731.
| Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $198 | 20 days | |
| 100 μg | $389 | 20 days | |
| 1 mg | $1,680 | 20 days |
Bulk & Custom
Add to Cart
Resource Download
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro. Catalyzes the conversion of leukotriene C4 to leukotriene F4 via the hydrolysis of an amide bond. Carboxypeptidase A1 Protein, Rat, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 39.6 kDa and the accession number is P00731. |
| Species | Rat |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | P00731 |
| Synonyms | Cpa1,Cpa,Carboxypeptidase A1 |
| Amino Acid | ALSTDSFNYATYHTLDEIYEFMDLLVAEHPQLVSKIQIGNTFEGRPIHVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQDPTFTAVLDNMDIFLEIVTNPDGFAYTHKTNRMWRKTRSHTQGSLCVGVDPNRNWDAGFGMAGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTSEPAPDQAELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY |
| Construction | 111-419 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 39.6 kDa (predicted) |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro. Catalyzes the conversion of leukotriene C4 to leukotriene F4 via the hydrolysis of an amide bond. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.