Shopping Cart
- Remove All
Your shopping cart is currently empty
CCL4 Protein, Mouse, Recombinant (His)
Resource Download
CCL4 Protein, Mouse, Recombinant (His)
Catalog No. TMPH-02567
Monokine with inflammatory and chemokinetic properties.
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose. | Pack Size | Price | Availability | Quantity |
|---|---|---|---|
| 20 μg | $284 | 20 days | |
| 100 μg | $537 | 20 days | |
| 1 mg | $2,300 | 20 days |
Bulk & Custom
Add to Cart
Biological Description
| Biological Information | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Monokine with inflammatory and chemokinetic properties. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P14097 |
| Synonyms | Immune activation protein 2,SIS-gamma,Mip1b,MIP-1-beta,ACT-2,C-C motif chemokine 4,Small-inducible cytokine A4,Protein H400,ACT2,Macrophage inflammatory protein 1-beta,Ccl4,Scya4 |
| Amino Acid | APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN |
| Construction | 24-92 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Molecular Weight | 11.8 kDa (predicted) |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
| Research Background | Monokine with inflammatory and chemokinetic properties. |
Dose Conversion
You can also refer to dose conversion for different animals. More
Calculator
Tech Support
Please read the User Guide of Recombinant Proteins for more specific information.
Preview
- TOP
Feedback
Hello! How can I help you today? 
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.