Chemotaxis inhibitory Protein, S. aureus (strain MRSA252), Recombinant (His)

Resource Download

COA

Chemotaxis inhibitory Protein, S. aureus (strain MRSA252), Recombinant (His)

Catalog No. TMPH-03529

Involved in countering the first line of host defense mechanisms. Specifically inhibits the response of human neutrophils and monocytes to complement anaphylatoxin C5a and formylated peptides, like N-formyl-methionyl-leucyl-phenylalanine (fMLP). Acts by binding directly to the C5a receptor (C5aR) and formylated peptide receptor (FPR), thereby blocking the C5a- and fMLP-induced calcium responses. Prevents phagocytosis of the bacterium. Chemotaxis inhibitory Protein, S. aureus (strain MRSA252), Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.1 kDa and the accession number is Q6GFB3.

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Pack Size	Price	Availability
20 μg	$397	20 days
100 μg	$769	20 days
500 μg	$1,780	20 days

Bulk & Custom

Add to Cart

Questions

Biological Description

Biological Information	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Involved in countering the first line of host defense mechanisms. Specifically inhibits the response of human neutrophils and monocytes to complement anaphylatoxin C5a and formylated peptides, like N-formyl-methionyl-leucyl-phenylalanine (fMLP). Acts by binding directly to the C5a receptor (C5aR) and formylated peptide receptor (FPR), thereby blocking the C5a- and fMLP-induced calcium responses. Prevents phagocytosis of the bacterium. Chemotaxis inhibitory Protein, S. aureus (strain MRSA252), Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 16.1 kDa and the accession number is Q6GFB3.
Species	Staphylococcus aureus
Expression System	P. pastoris (Yeast)
Tag	N-6xHis
Accession Number	Q6GFB3
Synonyms	CHIPS,Chemotaxis inhibitory protein,chp
Amino Acid	FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY
Construction	29-149 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	16.1 kDa (Predicted), 17 kDa (Reducing conditions)
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Involved in countering the first line of host defense mechanisms. Specifically inhibits the response of human neutrophils and monocytes to complement anaphylatoxin C5a and formylated peptides, like N-formyl-methionyl-leucyl-phenylalanine (fMLP). Acts by binding directly to the C5a receptor (C5aR) and formylated peptide receptor (FPR), thereby blocking the C5a- and fMLP-induced calcium responses. Prevents phagocytosis of the bacterium.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.