Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST)

Catalog No. TMPH-00183

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.8 kDa and the accession number is P05068.

Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST)

Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST)

Catalog No. TMPH-00183
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.8 kDa and the accession number is P05068.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$67820 days
1 mg$2,30020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.8 kDa and the accession number is P05068.
Species
Bacillus thuringiensis subsp. kurstaki
Expression System
E. coli
TagN-GST
Accession NumberP05068
Synonyms
Pesticidal crystal protein Cry1Ac,Insecticidal delta-endotoxin CryIA(c),Crystaline entomocidal protoxin,cryIA(c),cry218,cry1Ac,cry1A(c),133 kDa crystal protein
Amino Acid
LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Construction
972-1178 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight50.8 kDa (predicted)
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.