Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST)

Catalog No. TMPH-00183

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.8 kDa and the accession number is P05068.

Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST)

Catalog No. TMPH-00183

Pack Size	Price	Availability
20 μg	$360	20 days
100 μg	$678	20 days
1 mg	$2,300	20 days

Bulk & Custom

Add to Cart

Questions

Resource Download

User Guide of Recombinant Proteins

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity	Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description	Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae. Cry1Ac Protein, Bacillus thuringiensis subsp., Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 50.8 kDa and the accession number is P05068.
Species	Bacillus thuringiensis subsp. kurstaki
Expression System	E. coli
Tag	N-GST
Accession Number	P05068
Synonyms	Pesticidal crystal protein Cry1Ac,Insecticidal delta-endotoxin CryIA(c),Crystaline entomocidal protoxin,cryIA(c),cry218,cry1Ac,cry1A(c),133 kDa crystal protein
Amino Acid	LYDARNVIKNGDFNNGLSCWNVKGHVDVEEQNNQRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEIENNTDELKFSNCVEEEIYPNNTVTCNDYTVNQEEYGGAYTSRNRGYNEAPSVPADYASVYEEKSYTDGRRENPCEFNRGYRDYTPLPVGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Construction	972-1178 aa
Protein Purity	> 90% as determined by SDS-PAGE.
Molecular Weight	50.8 kDa (predicted)
Formulation	Tris-based buffer, 50% glycerol
Reconstitution	A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

Reconstitution Calculator
Recombinant Protein Dilution Calculator
Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.