Shopping Cart

Remove All

Your shopping cart is currently empty

Cry1Ia Protein, Bacillus thuringiensis subsp., Recombinant (His & KSI)

Resource Download

Cry1Ia Protein, Bacillus thuringiensis subsp., Recombinant (His & KSI)

Catalog No. TMPH-00181

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of certain coleopteran and lepidopteran species. Active on Plutella xylostella and Bombyx mori. Cry1Ia Protein, Bacillus thuringiensis subsp., Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 24.9 kDa and the accession number is Q45752.

All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Pack Size	Price	Availability
20 μg	$360	20 days
100 μg	$678	20 days
1 mg	$2,300	20 days

Bulk & Custom

Add to Cart

Questions

Biological Description

Description	Promotes colloidosmotic lysis by binding to the midgut epithelial cells of certain coleopteran and lepidopteran species. Active on Plutella xylostella and Bombyx mori. Cry1Ia Protein, Bacillus thuringiensis subsp., Recombinant (His & KSI) is expressed in E. coli expression system with N-6xHis-KSI tag. The predicted molecular weight is 24.9 kDa and the accession number is Q45752.
Species	Bacillus thuringiensis subsp. Kurstaki
Expression System	E. coli
Tag	N-6xHis-KSI
Accession Number	Q45752
Synonyms	cryV1,cry1Ia,cryV,81 kDa crystal protein,Insecticidal delta-endotoxin CryII(a),Crystaline entomocidal protoxin,Pesticidal crystal protein Cry1Ia,cryII(a),CGCryV
Amino Acid	GKNQWEIFMEHVEEIINQKISTYARNKALTDLKGLGDALAVYHDSLESWVGNRNNTRARSVVKSQYIALELMFVQKLPSFAVSG
Construction	97-180 aa
Protein Purity	> 85% as determined by SDS-PAGE.
Molecular Weight	24.9 kDa (predicted)
Formulation	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing.
Stability & Storage	Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
Shipping	In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background	Promotes colloidosmotic lysis by binding to the midgut epithelial cells of certain coleopteran and lepidopteran species. Active on Plutella xylostella and Bombyx mori.

Dose Conversion

You can also refer to dose conversion for different animals. More

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.