Shopping Cart
  • Remove All
  • TargetMol
    Your shopping cart is currently empty

DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His)

Catalog No. TMPH-03487

A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins. DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.5 kDa and the accession number is P18955.

DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His)

DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His)

Catalog No. TMPH-03487
A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins. DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.5 kDa and the accession number is P18955.
Pack SizePriceAvailabilityQuantity
20 μg$36020 days
100 μg$67820 days
1 mg$2,30020 days
Bulk & Custom
Add to Cart
Questions
View More
All TargetMol products are for research purposes only and cannot be used for human consumption. We do not provide products or services to individuals. Please comply with the intended use and do not use TargetMol products for any other purpose.

Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins. DNA-binding protein H-NS Protein, SerRatia marcescens, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 19.5 kDa and the accession number is P18955.
Species
Serratia marcescens
Expression System
E. coli
TagN-6xHis
Accession NumberP18955
Synonyms
hnsA,hns,Histone-like protein HLP-II,DNA-binding protein H-NS
Amino Acid
SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL
Construction
2-135 aa
Protein Purity
> 90% as determined by SDS-PAGE.
Molecular Weight19.5 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice.
Research Background
A DNA-binding protein implicated in transcriptional repression and chromosome organization and compaction. Binds nucleation sites in AT-rich DNA and bridges them, forming higher-order nucleoprotein complexes and condensing the chromosome. As many horizontally transferred genes are AT-rich, it plays a central role in silencing foreign genes. A subset of genes are repressed by H-NS in association with other proteins.

Dose Conversion

You can also refer to dose conversion for different animals. More

Calculator

  • Reconstitution Calculator
  • Recombinant Protein Dilution Calculator
  • Specific Activity Calculator

Tech Support

Please read the User Guide of Recombinant Proteins for more specific information.