Shopping Cart
- Remove All
![TargetMol](https://www.targetmol.com/storage/error/oops.webp)
Your shopping cart is currently empty
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $360 | 20 days | |
100 μg | $678 | 20 days | |
1 mg | $2,300 | 20 days |
Description | Virulence factor that is important for the establishment of infection in the host. EsxA is required for EsxB synthesis as well as secretion. Modulates host cell apoptotic pathways and mediates together with EsxB the release of S.aureus from the host cell. By acting on apoptosis, plays a role in the modulation of dendritic cell-mediated immunity. EsxA Protein, S. aureus, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 27.0 kDa and the accession number is Q6GCJ0. |
Species | Staphylococcus aureus |
Expression System | E. coli |
Tag | N-6xHis-SUMO |
Accession Number | Q6GCJ0 |
Synonyms | esxA,Type VII secretion system extracellular protein A |
Amino Acid | MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ |
Construction | 1-97 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 27.0 kDa (predicted) |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Virulence factor that is important for the establishment of infection in the host. EsxA is required for EsxB synthesis as well as secretion. Modulates host cell apoptotic pathways and mediates together with EsxB the release of S.aureus from the host cell. By acting on apoptosis, plays a role in the modulation of dendritic cell-mediated immunity. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.