Shopping Cart
- Remove All
- Your shopping cart is currently empty
FabB Protein, E. coli, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO and C-Myc tag. The predicted molecular weight is 61.3 kDa and the accession number is P0A953.
Pack Size | Price | Availability | Quantity |
---|---|---|---|
20 μg | $360 | 20 days | |
100 μg | $678 | 20 days | |
1 mg | $2,300 | 20 days |
Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
Description | FabB Protein, E. coli, Recombinant (His & Myc & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO and C-Myc tag. The predicted molecular weight is 61.3 kDa and the accession number is P0A953. |
Species | E. coli |
Expression System | E. coli |
Tag | N-6xHis-SUMO, C-Myc |
Accession Number | P0A953 |
Synonyms | fabB,Beta-ketoacyl-ACP synthase I,3-oxoacyl-[acyl-carrier-protein] synthase I,3-oxoacyl-[acyl-carrier-protein] synthase 1 |
Amino Acid | MKRAVITGLGIVSSIGNNQQEVLASLREGRSGITFSQELKDSGMRSHVWGNVKLDTTGLIDRKVVRFMSDASIYAFLSMEQAIADAGLSPEAYQNNPRVGLIAGSGGGSPRFQVFGADAMRGPRGLKAVGPYVVTKAMASGVSACLATPFKIHGVNYSISSACATSAHCIGNAVEQIQLGKQDIVFAGGGEELCWEMACEFDAMGALSTKYNDTPEKASRTYDAHRDGFVIAGGGGMVVVEELEHALARGAHIYAEIVGYGATSDGADMVAPSGEGAVRCMKMAMHGVDTPIDYLNSHGTSTPVGDVKELAAIREVFGDKSPAISATKAMTGHSLGAAGVQEAIYSLLMLEHGFIAPSINIEELDEQAAGLNIVTETTDRELTTVMSNSFGFGGTNATLVMRKLKD |
Construction | 1-406 aa |
Protein Purity | > 90% as determined by SDS-PAGE. |
Molecular Weight | 61.3 kDa (predicted) |
Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
Formulation | Tris-based buffer, 50% glycerol |
Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Shipping | In general, Lyophilized powders are shipping with blue ice. Solutions are shipping with dry ice. |
Research Background | Involved in the type II fatty acid elongation cycle. Catalyzes the elongation of a wide range of acyl-ACP by the addition of two carbons from malonyl-ACP to an acyl acceptor. Can also use unsaturated fatty acids. Catalyzes a key reaction in unsaturated fatty acid (UFA) synthesis, the elongation of the cis-3-decenoyl-ACP produced by FabA. Can use acyl chains from C-6 to C-14. Has an absolute requirement for an ACP substrate as the acyl donor, and no activity is detected when both substrates are based on CoA. |
Copyright © 2015-2024 TargetMol Chemicals Inc. All Rights Reserved.